Tested Applications
Positive WB detected in | HCT 116 cells, MCF-7 cells, HEK-293T cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
CoIP | See 1 publications below |
Product Information
27018-1-AP targets RNF113A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25313 Product name: Recombinant human RNF113A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-100 aa of BC000832 Sequence: GESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVY Predict reactive species |
Full Name | ring finger protein 113A |
Calculated Molecular Weight | 39 kDa |
Observed Molecular Weight | 40-50 kDa |
GenBank Accession Number | BC000832 |
Gene Symbol | RNF113A |
Gene ID (NCBI) | 7737 |
RRID | AB_2880724 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15541 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RNF113A antibody 27018-1-AP | Download protocol |
IHC protocol for RNF113A antibody 27018-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biomark Res EIF4A3-induced Circ_0001187 facilitates AML suppression through promoting ubiquitin-proteasomal degradation of METTL3 and decreasing m6A modification level mediated by miR-499a-5p/RNF113A pathway | ||
Am J Transl Res Prognostic value of RNF113A shows a correlation with immune infiltrates in colorectal cancer |