Tested Applications
| Positive WB detected in | HCT 116 cells, MCF-7 cells, HEK-293T cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
27018-1-AP targets RNF113A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25313 Product name: Recombinant human RNF113A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-100 aa of BC000832 Sequence: GESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVY Predict reactive species |
| Full Name | ring finger protein 113A |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC000832 |
| Gene Symbol | RNF113A |
| Gene ID (NCBI) | 7737 |
| RRID | AB_2880724 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15541 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RNF113A antibody 27018-1-AP | Download protocol |
| WB protocol for RNF113A antibody 27018-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomark Res EIF4A3-induced Circ_0001187 facilitates AML suppression through promoting ubiquitin-proteasomal degradation of METTL3 and decreasing m6A modification level mediated by miR-499a-5p/RNF113A pathway | ||
Am J Transl Res Prognostic value of RNF113A shows a correlation with immune infiltrates in colorectal cancer |





