RNF128 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85137-4-RR (same clone as 85137-4-PBS)

  Untreated and PNGase F-treated, PNGase F inhibitor-treated HT-29 cells were subjected to SDS PAGE followed by western blot with 85137-4-RR (RNF128 antibody) at a dilution of 1:1000, incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85137-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85137-4-RR (same clone as 85137-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85137-4-RR (RNF128 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85137-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85137-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85137-4-RR against Human RNF128 were performed. The affinity constant is 3.82 nM.

RNF128 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85137-4-PBS

Clone No.242759G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RNF128, EC:2.3.2.27, GRAIL, RING finger protein 128, RING-type E3 ubiquitin transferase RNF128

---

Product Information

85137-4-PBS targets RNF128 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22834

  Product name: Recombinant human RNF128 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 333-428 aa of BC063404

  Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS

• Full Name: ring finger protein 128
• Calculated Molecular Weight: 428 aa, 47 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC063404
• Gene Symbol: RNF128
• Gene ID (NCBI): 79589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TEB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNF128 (Ring Finger Protein 128), also known as GRAIL (Gene Related to Anergy in Lymphocytes), is an E3 ubiquitin ligase that plays key roles in immune regulation, tumor biology, and antiviral responses. Initially identified in T cells, it is highly expressed in anergic CD4+ T cells and contributes to the induction and maintenance of T-cell anergy by catalyzing the ubiquitination and degradation of critical T-cell signaling molecules such as CD40L, CD80, and Rho-family GTPases.