Tested Applications
| Positive WB detected in | mouse heart tissue, U2OS cells, SW480 cells, mouse kidney tissue, rat heart tissue |
| Positive IP detected in | SW480 cells |
| Positive IHC detected in | mouse brain tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
10185-1-AP targets RNF216 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0238 Product name: Recombinant human RNF216 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 73-276 aa of BC000787 Sequence: KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS Predict reactive species |
| Full Name | ring finger protein 216 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 57 kDa, 90-99 kDa, 106~130 kDa |
| GenBank Accession Number | BC000787 |
| Gene Symbol | RNF216 |
| Gene ID (NCBI) | 54476 |
| RRID | AB_2180806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NWF9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNF216/TRIAD3 is an RBR (RING-between-RING) E3 ligase that encodes for multiple isoforms that include TRIAD3A, TRIAD3B, TRIAD3C and TRIAD3D/E. RNF216 is a broadly expressed RBR E3 ligase, and loss-of-function mutations in RNF216 are linked to the neurode-generative conditions Gordon-Holmes syndrome (GHS) and Huntington-like disorders (PMID: 34998453, 35620441). RNF216 has three different molecular weights, 99 kDa, 106 kDa and 57 kDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNF216 antibody 10185-1-AP | Download protocol |
| IHC protocol for RNF216 antibody 10185-1-AP | Download protocol |
| IP protocol for RNF216 antibody 10185-1-AP | Download protocol |
| WB protocol for RNF216 antibody 10185-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















