RNF217 Polyclonal antibody

• 

  IHC staining of human liver using 26084-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26084-1-AP (RNF217 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 26084-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26084-1-AP (RNF217 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26084-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RNF217 antibody (26084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

RNF217 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26084-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

C6orf172, IBRDC1, ring finger protein 217, RNF217

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26084-1-AP targets RNF217 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22022

  Product name: Recombinant human RNF217 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-275 aa of BC026087

  Sequence: MKVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVRGSVCAGKLFIAPLIMVLGLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL

• Full Name: ring finger protein 217
• Calculated Molecular Weight: 275 aa, 32 kDa
• Observed Molecular Weight: 59, 32 kDa
• GenBank Accession Number: BC026087
• Gene Symbol: RNF217
• Gene ID (NCBI): 154214
• RRID: AB_3085839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TC41
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E3 ubiquitin-protein ligase RNF217, also known as IBR domain-containing protein 1 (IBRDC1), as a transmembrane (TM) domain-containing RBR-type E3 ubiquitin-protein ligase, belongs to a highly conserved member of the RING finger family. RNF217 mediates the degradation of the iron exporter ferroportin/SLC40A1 and thus regulates iron homeostasis(Uniprot, PMID: 33895792).