Tested Applications
| Positive WB detected in | human liver tissue, human heart tissue, human skeletal muscle tissue, human testis tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
Product Information
11905-1-AP targets RNF7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2553 Product name: Recombinant human SAG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC008627 Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK Predict reactive species |
| Full Name | ring finger protein 7 |
| Calculated Molecular Weight | 113 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC008627 |
| Gene Symbol | RNF7 |
| Gene ID (NCBI) | 9616 |
| RRID | AB_10697836 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBF6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNF7 antibody 11905-1-AP | Download protocol |
| IP protocol for RNF7 antibody 11905-1-AP | Download protocol |
| WB protocol for RNF7 antibody 11905-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO J RHEB neddylation by the UBE2F-SAG axis enhances mTORC1 activity and aggravates liver tumorigenesis | ||
Mol Cell Proteomics Neddylation-Cullin 2-RBX1 E3 ligase axis targets tumor suppressor RhoB for degradation in liver cancer.
| ||
Research (Wash D C) E3 Ligase Rbx1 Orchestrates Thymus Development and Fate Determination of αβ-γδ T Cells | ||
Nat Aging Cell type mapping of inflammatory muscle diseases highlights selective myofiber vulnerability in inclusion body myositis | ||
Dev Cell The UBE2F-CRL5ASB11-DIRAS2 axis is an oncogene and tumor suppressor cascade in pancreatic cancer cells |















