RNF7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RNF7 Polyclonal antibody (11905-1-AP)

• Featured Product
• KD/KO Validated

RNF7 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 11905-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Synonyms

CKBBP1, CKII beta-binding protein 1, RBX2, RING-box protein 2, ROC2

• 

  WB analysis of human liver using 11905-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11905-1-AP (RNF7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11905-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11905-1-AP (RNF7 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 11905-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11905-1-AP (RNF7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11905-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11905-1-AP (RNF7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 11905-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11905-1-AP (RNF7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 11905-1-AP

  IP result of anti-RNF7 (IP:11905-1-AP, 4ug; Detection:11905-1-AP 1:600) with mouse heart tissue lysate 4400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 11905-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 11905-1-AP (RNF7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 11905-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 11905-1-AP (RNF7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 11905-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 11905-1-AP (RNF7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 11905-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11905-1-AP (RNF7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 11905-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using RNF7 antibody (11905-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 11905-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RNF7 antibody (11905-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RNF7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, human heart tissue, human skeletal muscle tissue, human testis tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: mouse kidney tissue, human ovary cancer tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11905-1-AP targets RNF7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2553

  Product name: Recombinant human SAG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC008627

  Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

• Full Name: ring finger protein 7
• Calculated Molecular Weight: 113 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC008627
• Gene Symbol: RNF7
• Gene ID (NCBI): 9616
• RRID: AB_10697836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant.

Publications

What published studies show

RBX1 Antibody (Catalog No. 11905-1-AP) has 9 citations published in Nature Aging, Advanced Science, Research, Development Cell, EMBO Journal, Cell Reports, Molecular & Cellular Proteomics, FASEB Journal, and eLife. Associated research fields include E3 ubiquitin ligase biology, cancer (metastasis, chemosensitivity, liver and pancreatic tumorigenesis), T cell development, inflammatory muscle disease, and drug resistance mechanisms.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IHC	Nat Aging; Cell type mapping of inflammatory muscle diseases highlights selective myofiber vulnerability in inclusion body myositis; Authors - Sven Wischnewski
human	WB	Adv Sci (Weinh); The Crosstalk Between CRL5 and APC/C E3 Ligases Regulates Metastasis and Chemosensitivity of Cancer Cells.; Authors - Danrui Cui
mouse	WB	Research (Wash D C); E3 Ligase Rbx1 Orchestrates Thymus Development and Fate Determination of αβ-γδ T Cells; Authors - Di Wu
human	WB	Dev Cell; The UBE2F-CRL5ASB11-DIRAS2 axis is an oncogene and tumor suppressor cascade in pancreatic cancer cells; Authors - Yu Chang
human	WB	EMBO J; RHEB neddylation by the UBE2F-SAG axis enhances mTORC1 activity and aggravates liver tumorigenesis; Authors - Fengwu Zhang
mouse	WB	Cell Rep; The Cullin3-Rbx1-KLHL9 E3 ubiquitin ligase complex ubiquitinates Rheb and supports amino acid-induced mTORC1 activation; Authors - Yao Yao