Tested Applications
Positive WB detected in | HepG2 cells, SMMC-7721 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25685-1-AP targets RNFT2 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22313 Product name: Recombinant human RNFT2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 139-231 aa of BC011878 Sequence: LYVLYTFSSEIAPQHSNLGDRVSETLSKKKKKERREGGRKEGRKERKKAQLWPRCGYPLVSCLYVFLLFLFCHLPHLSLRPVSSSCGHCHPLW Predict reactive species |
Full Name | ring finger protein, transmembrane 2 |
Calculated Molecular Weight | 444 aa, 49 kDa |
Observed Molecular Weight | 49-59 kDa |
GenBank Accession Number | BC011878 |
Gene Symbol | RNFT2 |
Gene ID (NCBI) | 84900 |
RRID | AB_2880194 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96EX2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RNFT2 antibody 25685-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |