Tested Applications
Positive WB detected in | human kidney tissue, HeLa cells, human liver tissue |
Positive IP detected in | L02 cells |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | Hela cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 6 publications below |
CoIP | See 1 publications below |
Product Information
13743-1-AP targets RNMT in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4682 Product name: Recombinant human RNMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 128-476 aa of BC036798 Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ Predict reactive species |
Full Name | RNA (guanine-7-) methyltransferase |
Calculated Molecular Weight | 476 aa, 55 kDa |
Observed Molecular Weight | 55 kDa |
GenBank Accession Number | BC036798 |
Gene Symbol | RNMT |
Gene ID (NCBI) | 8731 |
RRID | AB_2181550 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43148 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNMT, also named as mRNA cap guanine-N7 methyltransferase or KIAA0398, is a 476 amino acid protein, which contains one mRNA cap 0 methyltransferase domain and belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family. RNMT localizes in the nucleus and is widely expressed in various tissues. RNMT as a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs and binds RNA containing 5'-terminal GpppC.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RNMT antibody 13743-1-AP | Download protocol |
IHC protocol for RNMT antibody 13743-1-AP | Download protocol |
IF protocol for RNMT antibody 13743-1-AP | Download protocol |
IP protocol for RNMT antibody 13743-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell RNA-Methylation-Dependent RNA Processing Controls the Speed of the Circadian Clock.
| ||
Nucleic Acids Res Inhibition of cytoplasmic cap methylation identifies 5' TOP mRNAs as recapping targets and reveals recapping sites downstream of native 5' ends. | ||
J Mol Biol Identification and Characterization of the Interaction Between the Methyl-7-Guanosine Cap Maturation Enzyme RNMT and the Cap-Binding Protein eIF4E. | ||
Heliyon RNA-related DNA damage and repair: The role of N7-methylguanosine in the cell nucleus exposed to UV light | ||
ACS Chem Biol Comparative Analysis of Two NNMT Bisubstrate Inhibitors through Chemoproteomic Studies: Uncovering the Role of Unconventional SAM Analogue Moiety for Improved Selectivity | ||
Immunobiology Identification of RNMT as an immunotherapeutic and prognostic biomarker: From pan-cancer analysis to lung squamous cell carcinoma validation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Karthik Subramanian (Verified Customer) (07-18-2019) | The antibody initially worked very well for my western blot applications. Subsequently, however, its performance has considerably become poorer and often results in fainter bands with some amount of non-specificity.
|