Tested Applications
| Positive WB detected in | human kidney tissue, HeLa cells, human liver tissue, HepG2 cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13743-1-AP targets RNMT in WB, IHC, IF/ICC, IP, CoIP, ELISA, CUT&Tag applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4682 Product name: Recombinant human RNMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 128-476 aa of BC036798 Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ Predict reactive species |
| Full Name | RNA (guanine-7-) methyltransferase |
| Calculated Molecular Weight | 476 aa, 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC036798 |
| Gene Symbol | RNMT |
| Gene ID (NCBI) | 8731 |
| RRID | AB_2181550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNMT, also named as mRNA cap guanine-N7 methyltransferase or KIAA0398, is a 476 amino acid protein, which contains one mRNA cap 0 methyltransferase domain and belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family. RNMT localizes in the nucleus and is widely expressed in various tissues. RNMT as a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs and binds RNA containing 5'-terminal GpppC.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNMT antibody 13743-1-AP | Download protocol |
| IHC protocol for RNMT antibody 13743-1-AP | Download protocol |
| IP protocol for RNMT antibody 13743-1-AP | Download protocol |
| WB protocol for RNMT antibody 13743-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RNMT antibody (Cat# 13743-1-AP) has 7 total citations. These appear in journals including Cell, Nucleic Acids Research, Journal of Molecular Biology, ACS Chemical Biology, Immunobiology, Heliyon, and Molecular Cell. The associated research fields span RNA methylation and processing, the circadian clock, cytoplasmic cap methylation, RNMT–eIF4E interactions, NNMT inhibitor chemoproteomics, RNMT as a cancer immunotherapeutic/prognostic biomarker, and N7-methylguanosine–related DNA damage and repair.
| Species | Application | Title |
|---|---|---|
Cell RNA-Methylation-Dependent RNA Processing Controls the Speed of the Circadian Clock.
| ||
Nucleic Acids Res Inhibition of cytoplasmic cap methylation identifies 5' TOP mRNAs as recapping targets and reveals recapping sites downstream of native 5' ends. | ||
J Mol Biol Identification and Characterization of the Interaction Between the Methyl-7-Guanosine Cap Maturation Enzyme RNMT and the Cap-Binding Protein eIF4E. | ||
ACS Chem Biol Comparative Analysis of Two NNMT Bisubstrate Inhibitors through Chemoproteomic Studies: Uncovering the Role of Unconventional SAM Analogue Moiety for Improved Selectivity | ||
Immunobiology Identification of RNMT as an immunotherapeutic and prognostic biomarker: From pan-cancer analysis to lung squamous cell carcinoma validation | ||
Heliyon RNA-related DNA damage and repair: The role of N7-methylguanosine in the cell nucleus exposed to UV light |
Reviews
What customers say
The single review for this antibody (rated 3/5) reports that it initially performed well for Western blotting but that performance declined over time, with later use producing fainter bands and some non-specificity. The reviewer used a 1:500 dilution on HeLa cells. Overall, the feedback suggests the antibody is capable of good WB results but may show lot-to-lot or time-dependent variability in signal strength and specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Karthik Subramanian (Verified Customer) (07-18-2019) | The antibody initially worked very well for my western blot applications. Subsequently, however, its performance has considerably become poorer and often results in fainter bands with some amount of non-specificity.
|
