Tested Applications
| Positive WB detected in | human kidney tissue, HeLa cells, human liver tissue |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| CoIP | See 1 publications below |
Product Information
13743-1-AP targets RNMT in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4682 Product name: Recombinant human RNMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 128-476 aa of BC036798 Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ Predict reactive species |
| Full Name | RNA (guanine-7-) methyltransferase |
| Calculated Molecular Weight | 476 aa, 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC036798 |
| Gene Symbol | RNMT |
| Gene ID (NCBI) | 8731 |
| RRID | AB_2181550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNMT, also named as mRNA cap guanine-N7 methyltransferase or KIAA0398, is a 476 amino acid protein, which contains one mRNA cap 0 methyltransferase domain and belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family. RNMT localizes in the nucleus and is widely expressed in various tissues. RNMT as a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs and binds RNA containing 5'-terminal GpppC.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RNMT antibody 13743-1-AP | Download protocol |
| IHC protocol for RNMT antibody 13743-1-AP | Download protocol |
| IP protocol for RNMT antibody 13743-1-AP | Download protocol |
| WB protocol for RNMT antibody 13743-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell RNA-Methylation-Dependent RNA Processing Controls the Speed of the Circadian Clock.
| ||
Nucleic Acids Res Inhibition of cytoplasmic cap methylation identifies 5' TOP mRNAs as recapping targets and reveals recapping sites downstream of native 5' ends. | ||
J Mol Biol Identification and Characterization of the Interaction Between the Methyl-7-Guanosine Cap Maturation Enzyme RNMT and the Cap-Binding Protein eIF4E. | ||
Immunobiology Identification of RNMT as an immunotherapeutic and prognostic biomarker: From pan-cancer analysis to lung squamous cell carcinoma validation | ||
ACS Chem Biol Comparative Analysis of Two NNMT Bisubstrate Inhibitors through Chemoproteomic Studies: Uncovering the Role of Unconventional SAM Analogue Moiety for Improved Selectivity | ||
Heliyon RNA-related DNA damage and repair: The role of N7-methylguanosine in the cell nucleus exposed to UV light |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Karthik Subramanian (Verified Customer) (07-18-2019) | The antibody initially worked very well for my western blot applications. Subsequently, however, its performance has considerably become poorer and often results in fainter bands with some amount of non-specificity.
|













