Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24116-1-AP targets RPAP1 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7856 Product name: Recombinant human RPAP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-351 aa of BC000246 Sequence: MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT Predict reactive species |
| Full Name | RNA polymerase II associated protein 1 |
| Calculated Molecular Weight | 153 kDa |
| Observed Molecular Weight | 153 kDa |
| GenBank Accession Number | BC000246 |
| Gene Symbol | RPAP1 |
| Gene ID (NCBI) | 26015 |
| RRID | AB_2879435 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9BWH6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNA polymerase II-associated protein 1 (RPAP1) encodes a nuclear 153-kDa protein, and forms an interface between the RNA polymerase II (RNAPII) enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. RPAP1 is required for interaction of the RNA polymerase II complex with acetylated histone H3 and the subsequent DNA transcription.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RPAP1 antibody 24116-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

