RPAP1 Polyclonal antibody, PBS Only

• 

  WB analysis using 24116-1-AP (same clone as 24116-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24116-1-AP (RPAP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24116-1-PBS in a different storage buffer formulation.

RPAP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24116-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24116-1-PBS targets RPAP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7856

  Product name: Recombinant human RPAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC000246

  Sequence: MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT

• Full Name: RNA polymerase II associated protein 1
• Calculated Molecular Weight: 153 kDa
• Observed Molecular Weight: 153 kDa
• GenBank Accession Number: BC000246
• Gene Symbol: RPAP1
• Gene ID (NCBI): 26015
• RRID: AB_2879435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9BWH6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNA polymerase II-associated protein 1 (RPAP1) encodes a nuclear 153-kDa protein, and forms an interface between the RNA polymerase II (RNAPII) enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. RPAP1 is required for interaction of the RNA polymerase II complex with acetylated histone H3 and the subsequent DNA transcription.