RPL13 Polyclonal antibody

• 

  WB analysis of HeLa using 11271-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11271-1-AP (RPL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 11271-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11271-1-AP (RPL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 11271-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 11271-1-AP (RPL13 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11271-1-AP

  IP result of anti-RPL13 (IP:11271-1-AP, 4ug; Detection:11271-1-AP 1:300) with HeLa cells lysate 3000 ug.

• 

  IHC staining of human colon cancer using 11271-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11271-1-AP (RPL13 antibody) at dilution of 1:50 (under 10x lens).

RPL13 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11271-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

60S ribosomal protein L13, BBC1, D16S444E, Large ribosomal subunit protein eL13, OK/SW-cl.46

---

Tested Applications

• Positive WB detected in: HeLa cells, SGC-7901 cells, human lung tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 2 publications below

Product Information

11271-1-AP targets RPL13 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1814

  Product name: Recombinant human RPL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC014167

  Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKA

• Full Name: ribosomal protein L13
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC014167
• Gene Symbol: RPL13
• Gene ID (NCBI): 6137
• RRID: AB_2269735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26373
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian ribosome comprises 79 ribosomal proteins and four rRNAs, which combine in equimolar ratios to form the small (40S) and large (60S) subunits. Ribosome proteins are a direct and critical target of the PI3K pathway in promoting growth.[PMID:15289434]. RPL13 may be a plausible candidate tumor suppressor gene, as knocking down L13 expression using small interfering RNA (siRNA) resulted in drastic attenuation of cancer cell growth with significant G1 and G2/M arrest of the cell cycle[PMID:16786168].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell Res; Pre-ribosomal RNA reorganizes DNA damage repair factors in nucleus during meiotic prophase and DNA damage response.; Authors - Xiaochen Gai
human	WB	Cell Discov; Ribosomal RNA regulates chromosome clustering during mitosis.; Authors - Kai Ma
mouse	WB	Ecotoxicol Environ Saf; ZEA and DON inhibited inflammation after L. monocytogenes infection and induced ribosomal hyperfunction.; Authors - Guodong Cai
human	WB	Mol Cell Proteomics; Proteomic landscape of exosomes reveals the functional contributions of CD151 in triple-negative breast cancer.; Authors - Sipeng Li
mouse	WB	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin
mouse	IF	Cell Rep; Single-nucleus profiling of mouse inner ear aging uncovers cell type heterogeneity and hair cell subtype-specific age-related signatures; Authors - Mingyu Xia