RPL29 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83377-2-RR (same clone as 83377-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83377-2-RR (RPL29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83377-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83377-2-RR (same clone as 83377-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RPL29 antibody (83377-2-RR, Clone: 240062A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83377-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83377-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83377-2-RR against Human RPL29 were performed. The affinity constant is 1.04 nM.

RPL29 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 83377-2-PBS

Clone No.240062A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Large ribosomal subunit protein eL29, HUMRPL29, HIP, Cell surface heparin-binding protein HIP, 60S ribosomal protein L29

---

Product Information

83377-2-PBS targets RPL29 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34100

  Product name: Recombinant human RPL29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-97 aa of BC008926

  Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA

• Full Name: ribosomal protein L29
• Calculated Molecular Weight: 159 aa, 18 kDa
• GenBank Accession Number: BC008926
• Gene Symbol: RPL29
• Gene ID (NCBI): 6159
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P47914
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.