Filter: AllWBIF/ICCAffinity

WB analysis using 83377-2-RR (same clone as 83377-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 83377-2-RR (RPL29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83377-2-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 83377-2-RR (same clone as 83377-2-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RPL29 antibody (83377-2-RR, Clone: 240062A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83377-2-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 83377-2-RR
Biolayer interferometry (BLl) kinetic assays of 83377-2-RR against Human RPL29 were performed. The affinity constant is 1.04 nM.

RPL29 Recombinant monoclonal antibody, PBS Only

Name: RPL29 Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 83377-2-PBS

RPL29 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 83377-2-PBS

Clone No.240062A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Large ribosomal subunit protein eL29, HUMRPL29, HIP, Cell surface heparin-binding protein HIP, 60S ribosomal protein L29

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

83377-2-PBS targets RPL29 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species
Full Name	ribosomal protein L29
Calculated Molecular Weight	159 aa, 18 kDa
GenBank Accession Number	BC008926
Gene Symbol	RPL29
Gene ID (NCBI)	6159
RRID	AB_3671031
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	P47914
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™