Tested Applications
| Positive WB detected in | RAW 264.7 cells, HEK-293 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human lung cancer tissue, human placenta tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66130-1-Ig targets RPL3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20400 Product name: Recombinant human RPL3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 153-403 aa of BC012786 Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA Predict reactive species |
| Full Name | ribosomal protein L3 |
| Calculated Molecular Weight | 46/27 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC012786 |
| Gene Symbol | RPL3 |
| Gene ID (NCBI) | 6122 |
| RRID | AB_2881529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P39023 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RPL3 antibody 66130-1-Ig | Download protocol |
| IHC protocol for RPL3 antibody 66130-1-Ig | Download protocol |
| WB protocol for RPL3 antibody 66130-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RPL3 Monoclonal antibody (2G1B8), catalog number 66130-1-Ig, has 6 total citations. These appear in Nature, Nature Communications, International Journal of Biological Sciences, Molecular Metabolism, Journal of Biological Chemistry, and eLife. Research fields span organelle distribution and tubulin regulation, mitochondrial ribosome biogenesis, HER2-negative breast cancer oncogenic signaling, pancreatic proteostasis, cardiac homeostasis and cardiomyopathy, and translation elongation.
| Species | Application | Title |
|---|---|---|
Nat Commun Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling. | ||
Int J Biol Sci METTL18 functions as a Phenotypic Regulator in Src-Dependent Oncogenic Responses of HER2-Negative Breast Cancer | ||
Mol Metab METTL18 ensures pancreatic function by maintaining proper translation and proteostasis. | ||
J Biol Chem Disruption of valosin-containing protein activity causes cardiomyopathy and reveals pleiotropic functions in cardiac homeostasis. | ||
Elife METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance. |
Reviews
What customers say
The product has one verified review. A researcher named Aditya Chandru rated it 5 out of 5 stars for Western Blot (lot 10004305), noting that it "works well with HRP." Overall, the feedback is positive, confirming reliable performance in WB applications with HRP conjugation.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aditya (Verified Customer) (11-01-2024) | works well with hrp
|
