Use Able AI chat for product recommendations

RPL3 Monoclonal antibody

RPL3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66130-1-Ig
Clone No. 2G1B8
Publications (6)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

60S ribosomal protein L3, ribosomal protein L3, RPL3, TARBP B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RPL3 in ?

Tested Applications

Positive WB detected inRAW 264.7 cells, HEK-293 cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue, human lung cancer tissue, human placenta tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66130-1-Ig targets RPL3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20400

Product name: Recombinant human RPL3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 153-403 aa of BC012786

Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA

Predict reactive species
Full Name ribosomal protein L3
Calculated Molecular Weight 46/27 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC012786
Gene Symbol RPL3
Gene ID (NCBI) 6122
RRIDAB_2881529
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP39023
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Protocols

Product Specific Protocols
IF protocol for RPL3 antibody 66130-1-IgDownload protocol
IHC protocol for RPL3 antibody 66130-1-IgDownload protocol
WB protocol for RPL3 antibody 66130-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

RPL3 Monoclonal antibody (2G1B8), catalog number 66130-1-Ig, has 6 total citations. These appear in Nature, Nature Communications, International Journal of Biological Sciences, Molecular Metabolism, Journal of Biological Chemistry, and eLife. Research fields span organelle distribution and tubulin regulation, mitochondrial ribosome biogenesis, HER2-negative breast cancer oncogenic signaling, pancreatic proteostasis, cardiac homeostasis and cardiomyopathy, and translation elongation.

SpeciesApplicationTitle
humanIF

Nature

ER proteins decipher the tubulin code to regulate organelle distribution

Authors - Pengli Zheng
humanWB

Nat Commun

Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.

Authors - Hauke S Hillen
humanWB

Int J Biol Sci

METTL18 functions as a Phenotypic Regulator in Src-Dependent Oncogenic Responses of HER2-Negative Breast Cancer

Authors - Han Gyung Kim
mouseWB

Mol Metab

METTL18 ensures pancreatic function by maintaining proper translation and proteostasis.

Authors - Tadahiro Shimazu
mouseIF

J Biol Chem

Disruption of valosin-containing protein activity causes cardiomyopathy and reveals pleiotropic functions in cardiac homeostasis.

Authors - Matthew J Brody
humanWB

Elife

METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.

Authors - Eriko Matsuura-Suzuki

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one verified review. A researcher named Aditya Chandru rated it 5 out of 5 stars for Western Blot (lot 10004305), noting that it "works well with HRP." Overall, the feedback is positive, confirming reliable performance in WB applications with HRP conjugation.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aditya (Verified Customer) (11-01-2024)

works well with hrp

  • Applications: Western Blot
Loading...
||
New chat

Able™

正在加载,请稍候...