RPL3 Fusion Protein

Source

E. coli-derived, PET28a

Tag

6*His

Format

Liquid

Cat no : Ag20400

Synonyms

MGC104284; TARBP-B



Product Information

Peptide Sequence MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA
(153-403 aa encoded by BC012786)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.