RPL36AL Polyclonal antibody

• 

  IHC staining of human breast cancer using 15535-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15535-1-AP (RPL36AL Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver cancer using 15535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15535-1-AP (RPL36AL Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 15535-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15535-1-AP (RPL36AL Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 15535-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15535-1-AP (RPL36AL Antibody) at dilution of 1:50 (under 10x lens).

RPL36AL Polyclonal Antibody for IHC, ELISA

Cat No. 15535-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

ribosomal protein L36a like, RPL36A, RPL36AL

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15535-1-AP targets RPL36AL in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7853

  Product name: Recombinant human RPL36AL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC000741

  Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

• Full Name: ribosomal protein L36a-like
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC000741
• Gene Symbol: RPL36AL
• Gene ID (NCBI): 6166
• RRID: AB_2878148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969Q0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.