Tested Applications
Positive WB detected in | HL-60 cells, mouse liver tissue |
Positive IHC detected in | mouse kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
16805-1-AP targets RPLP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10293 Product name: Recombinant human RPLP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC062314 Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD Predict reactive species |
Full Name | ribosomal protein, large, P2 |
Calculated Molecular Weight | 115 aa, 12 kDa |
Observed Molecular Weight | 15 kDa |
GenBank Accession Number | BC062314 |
Gene Symbol | RPLP2 |
Gene ID (NCBI) | 6181 |
RRID | AB_2878318 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05387 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RPLP2 antibody 16805-1-AP | Download protocol |
IHC protocol for RPLP2 antibody 16805-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep Ribosome customization and functional diversification among P-stalk proteins regulate late poxvirus protein synthesis |