RPLP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPLP2 Polyclonal antibody (16805-1-AP)

RPLP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16805-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

D11S2243E, P2, ribosomal protein, large, P2, RPLP2, RPP2

• 

  WB analysis using 16805-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16805-1-AP (RPLP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16805-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16805-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16805-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16805-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPLP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse liver tissue
• Positive IHC detected in: mouse kidney tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16805-1-AP targets RPLP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10293

  Product name: Recombinant human RPLP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC062314

  Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

• Full Name: ribosomal protein, large, P2
• Calculated Molecular Weight: 115 aa, 12 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC062314
• Gene Symbol: RPLP2
• Gene ID (NCBI): 6181
• RRID: AB_2878318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05387
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RPLP2 Polyclonal antibody (Cat# 16805-1-AP) has 3 total citations published in Science Advances, International Journal of Biological Macromolecules, and Cell Reports. The associated research fields include leukemia and chemoresistance, glioblastoma progression and translational regulation, and poxvirus protein synthesis involving ribosomal P-stalk proteins. All cited applications are Western blot (WB) in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Ribosome changes reprogram translation for chemosurvival in G0 leukemic cells; Authors - Chandreyee Datta
human	WB	Int J Biol Macromol; Translational hub ribosomal protein S5 promotes glioblastoma progression by affecting translation patterns.; Authors - Lin Wang
	WB	Cell Rep; Ribosome customization and functional diversification among P-stalk proteins regulate late poxvirus protein synthesis; Authors - Natalia Khalatyan