RPLP2 Polyclonal antibody, PBS Only

• 

  WB analysis using 16805-1-AP (same clone as 16805-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16805-1-AP (RPLP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16805-1-AP (same clone as 16805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16805-1-AP (same clone as 16805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 16805-1-AP (same clone as 16805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16805-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 16805-1-AP (same clone as 16805-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16805-1-AP (RPLP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16805-1-PBS in a different storage buffer formulation.

RPLP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16805-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16805-1-PBS targets RPLP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10293

  Product name: Recombinant human RPLP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC062314

  Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

• Full Name: ribosomal protein, large, P2
• Calculated Molecular Weight: 115 aa, 12 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC062314
• Gene Symbol: RPLP2
• Gene ID (NCBI): 6181
• RRID: AB_2878318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05387
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.