Tested Applications
Positive WB detected in | SH-SY5Y cells, mouse brain tissue, human heart tissue, HepG2 cells |
Positive IP detected in | SH-SY5Y cells |
Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
15871-1-AP targets RPS27L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8628 Product name: Recombinant human RPS27L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC003667 Sequence: MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH Predict reactive species |
Full Name | ribosomal protein S27-like |
Calculated Molecular Weight | 84 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC003667 |
Gene Symbol | RPS27L |
Gene ID (NCBI) | 51065 |
RRID | AB_2253903 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q71UM5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RPS27L antibody 15871-1-AP | Download protocol |
IHC protocol for RPS27L antibody 15871-1-AP | Download protocol |
IF protocol for RPS27L antibody 15871-1-AP | Download protocol |
IP protocol for RPS27L antibody 15871-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Elife Subfunctionalized expression drives evolutionary retention of ribosomal protein paralogs Rps27 and Rps27l in vertebrates | ||
J Mol Biol Defective Human SRP Induces Protein Quality Control and Triggers Stress Response |