RPS27L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPS27L Polyclonal antibody (15871-1-AP)

RPS27L Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15871-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

40S ribosomal protein S27-like, Ribosomal protein eS27-like, RPS, Small ribosomal subunit protein eS27-like

• 

  WB analysis of SH-SY5Y using 15871-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15871-1-AP (RPS27L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15871-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15871-1-AP (RPS27L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 15871-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15871-1-AP (RPS27L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15871-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15871-1-AP (RPS27L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 15871-1-AP

  IP result of anti-RPS27L (IP:15871-1-AP, 4ug; Detection:15871-1-AP 1:300) with SH-SY5Y cells lysate 2160 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 15871-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15871-1-AP (RPS27L antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 15871-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed SH-SY5Y cells using 15871-1-AP (RPS27L antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPS27L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, mouse brain tissue, human heart tissue, HepG2 cells
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15871-1-AP targets RPS27L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8628

  Product name: Recombinant human RPS27L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-84 aa of BC003667

  Sequence: MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

• Full Name: ribosomal protein S27-like
• Calculated Molecular Weight: 84 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC003667
• Gene Symbol: RPS27L
• Gene ID (NCBI): 51065
• RRID: AB_2253903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q71UM5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RPS27L Polyclonal antibody (Cat# 15871-1-AP) has 4 total citations published in Zool Res, J Mol Biol, iScience, and Elife. The associated research fields include DNA replication stress in fibroblasts, protein quality control and stress responses, caloric restriction and mitochondrial proteostasis, and evolutionary retention of ribosomal protein paralogs in vertebrates.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Zool Res; Features and mechanisms of long-lived Myotis somatic fibroblasts in response to DNA replication stress; Authors - Xiao-Yan Huang
human	WB	J Mol Biol; Defective Human SRP Induces Protein Quality Control and Triggers Stress Response; Authors - Elena B Tikhonova
		iScience; Caloric Restriction Induces MicroRNAs to Improve Mitochondrial Proteostasis.; Authors - Ran Zhang
mouse	WB	Elife; Subfunctionalized expression drives evolutionary retention of ribosomal protein paralogs Rps27 and Rps27l in vertebrates; Authors - Adele Francis Xu