Tested Applications
| Positive WB detected in | NIH/3T3 cells, K-562 cells, MCF-7 cells, HepG2 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human kidney tissue, mouse colon tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue, mouse brain tissue |
| Positive IF/ICC detected in | HepG2 cells, HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
23762-1-AP targets RSK2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20620 Product name: Recombinant human RPS6KA3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 666-740 aa of BC096301 Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL Predict reactive species |
| Full Name | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
| Calculated Molecular Weight | 740 aa, 84 kDa |
| Observed Molecular Weight | 84 kDa |
| GenBank Accession Number | BC096301 |
| Gene Symbol | RSK2 |
| Gene ID (NCBI) | 6197 |
| RRID | AB_2879318 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51812 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RSK2 antibody 23762-1-AP | Download protocol |
| IHC protocol for RSK2 antibody 23762-1-AP | Download protocol |
| IP protocol for RSK2 antibody 23762-1-AP | Download protocol |
| WB protocol for RSK2 antibody 23762-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Lett RSK2-mediated phosphorylation and degradation of UBE2O inhibits hepatocellular carcinoma growth and resistance to radiotherapy
| ||
Theranostics S6K1 phosphorylation-dependent degradation of Mxi1 by β-Trcp ubiquitin ligase promotes Myc activation and radioresistance in lung cancer. | ||
Cell Death Differ β-Trcp ubiquitin ligase and RSK2 kinase-mediated degradation of FOXN2 promotes tumorigenesis and radioresistance in lung cancer. | ||
Oncogene β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma. | ||
Int J Biochem Cell Biol DHPAC, a novel synthetic microtubule destabilizing agent, possess high anti-tumor activity in vincristine-resistant oral epidermoid carcinoma in vitro and in vivo. | ||
Prostate MicroRNA181c inhibits prostate cancer cell growth and invasion by targeting multiple ERK signaling pathway components. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Iram (Verified Customer) (03-23-2026) |
|
FH Sai Sindhura (Verified Customer) (03-23-2026) | Sharp bands with this antibody
|
FH Sai Sindhura (Verified Customer) (01-08-2026) | RSK 2 antibody is showing very good bands
|
FH Iram (Verified Customer) (12-19-2025) | Very clear band.
|
FH Iram (Verified Customer) (09-18-2025) | Very good antibody
|
FH Morgane (Verified Customer) (09-15-2025) | Very clean band at expected size and a couple aspecific higher ones
![]() |
FH Iram (Verified Customer) (09-04-2020) | Very clean bands of RSK2 in immunoblotting
|






































