Tested Applications
Positive WB detected in | A549 cells, Jurkat cells, NIH/3T3 cells, HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
Product Information
26989-1-AP targets RRAGC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25780 Product name: Recombinant human RRAGC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC016668 Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGP Predict reactive species |
Full Name | Ras-related GTP binding C |
Calculated Molecular Weight | 44 kDa |
Observed Molecular Weight | 44 kDa |
GenBank Accession Number | BC016668 |
Gene Symbol | RRAGC |
Gene ID (NCBI) | 64121 |
RRID | AB_2880714 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9HB90 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RRAGC (Ras-related GTP-binding protein C) is a small monomeric GTPase that functions as part of the mTORC1 nutrient-sensing pathway. Together with its dimerization partners RRAGA or RRAGB, RRAGC localizes mainly to the cytoplasm and, in response to amino-acid availability, recruits the mTORC1 complex to the lysosomal surface where mTORC1 can be activated by Rheb. This makes RRAGC a key molecular switch linking cellular metabolic state to growth control.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRAGC antibody 26989-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity. | ||
Genet Med De novo missense variants in RRAGC lead to a fatal mTORopathy of early childhood | ||
Cell Death Dis Inosine enhances tumor mitochondrial respiration by inducing Rag GTPases and nascent protein synthesis under nutrient starvation | ||
Cell Metab Pyruvate metabolism enzyme DLAT promotes tumorigenesis by suppressing leucine catabolism |