RRAGC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RRAGC Polyclonal antibody (26989-1-AP)

• Featured Product
• KD/KO Validated

RRAGC Polyclonal Antibody for WB, IP, ELISA

Cat No. 26989-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

EC:3.6.5.-, GTPase interacting protein 2, GTPase-interacting protein 2, GTR2, Rag C

• 

  WB analysis using 26989-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 26989-1-AP

  WB result of RRAGC antibody (26989-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RRAGC transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 26989-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293T using 26989-1-AP

  IP result of anti-RRAGC (IP:26989-1-AP, 4ug; Detection:26989-1-AP 1:1500) with HEK-293T cells lysate 1600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RRAGC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, NIH/3T3 cells, HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells
• Positive IP detected in: HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26989-1-AP targets RRAGC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25780

  Product name: Recombinant human RRAGC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC016668

  Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGP

• Full Name: Ras-related GTP binding C
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC016668
• Gene Symbol: RRAGC
• Gene ID (NCBI): 64121
• RRID: AB_2880714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB90
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRAGC (Ras-related GTP-binding protein C) is a small monomeric GTPase that functions as part of the mTORC1 nutrient-sensing pathway. Together with its dimerization partners RRAGA or RRAGB, RRAGC localizes mainly to the cytoplasm and, in response to amino-acid availability, recruits the mTORC1 complex to the lysosomal surface where mTORC1 can be activated by Rheb. This makes RRAGC a key molecular switch linking cellular metabolic state to growth control.

Publications

What published studies show

The RRAGC Polyclonal antibody (catalog no. 26989-1-AP) has 6 citations. These appear in Cell Metabolism, Autophagy, Cell Death & Disease, Genetics in Medicine, the FASEB Journal, and International Immunopharmacology. The associated research fields include pyruvate metabolism and tumorigenesis, mTORC1 regulation, mitochondrial respiration, mTORopathy, mitochondrial function in cardiomyocytes, and autophagy in diabetic nephropathy.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Cell Metab; Pyruvate metabolism enzyme DLAT promotes tumorigenesis by suppressing leucine catabolism; Authors - Ning Wang
human	WB	Autophagy; KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity.; Authors - Guokai Yan
mouse,human	WB,IHC	Cell Death Dis; Inosine enhances tumor mitochondrial respiration by inducing Rag GTPases and nascent protein synthesis under nutrient starvation; Authors - Mei-Xin Li
human	WB	Genet Med; De novo missense variants in RRAGC lead to a fatal mTORopathy of early childhood; Authors - Margot R F Reijnders
human	WB	FASEB J; Integrating Multiomics to Reveal and Validate Key Proteins, Metabolites, and Pathways of ASB14 Affecting Mitochondrial Function in Cardiomyocytes AC16; Authors - Che Wang
		Int Immunopharmacol; m5C demethylase TET2 promotes autophagy and alleviates podocyte injury in diabetic nephropathy by regulating RRAGC.; Authors - Yu Ma