RRAGC Polyclonal antibody

• 

  WB analysis of Jurkat using 26989-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26989-1-AP

  WB result of RRAGC antibody (26989-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RRAGC transfected Jurkat cells.

• 

  WB analysis of HEK-293T using 26989-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26989-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 26989-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 26989-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26989-1-AP (RRAGC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

RRAGC Polyclonal Antibody for WB, ELISA

Cat No. 26989-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

EC:3.6.5.-, GTPase interacting protein 2, GTPase-interacting protein 2, GTR2, Rag C

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, MCF-7 cells, HEK-293T cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

26989-1-AP targets RRAGC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25780

  Product name: Recombinant human RRAGC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC016668

  Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGP

• Full Name: Ras-related GTP binding C
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC016668
• Gene Symbol: RRAGC
• Gene ID (NCBI): 64121
• RRID: AB_2880714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB90
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRAGC (Ras-related GTP-binding protein C) is a small monomeric GTPase that functions as part of the mTORC1 nutrient-sensing pathway. Together with its dimerization partners RRAGA or RRAGB, RRAGC localizes mainly to the cytoplasm and, in response to amino-acid availability, recruits the mTORC1 complex to the lysosomal surface where mTORC1 can be activated by Rheb. This makes RRAGC a key molecular switch linking cellular metabolic state to growth control.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity.; Authors - Guokai Yan
human	WB	Genet Med; De novo missense variants in RRAGC lead to a fatal mTORopathy of early childhood; Authors - Margot R F Reijnders
mouse,human	WB,IHC	Cell Death Dis; Inosine enhances tumor mitochondrial respiration by inducing Rag GTPases and nascent protein synthesis under nutrient starvation; Authors - Mei-Xin Li
human	WB,IP	Cell Metab; Pyruvate metabolism enzyme DLAT promotes tumorigenesis by suppressing leucine catabolism; Authors - Ning Wang