Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, K-562 cells, mouse testis tissue |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| ChIP | See 1 publications below |
Product Information
25918-1-AP targets RRN3 in WB, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23207 Product name: Recombinant human RRN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 268-365 aa of BC132688 Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ Predict reactive species |
| Full Name | RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
| Observed Molecular Weight | 74 kDa |
| GenBank Accession Number | BC132688 |
| Gene Symbol | RRN3 |
| Gene ID (NCBI) | 54700 |
| RRID | AB_2880296 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for RRN3 antibody 25918-1-AP | Download protocol |
| WB protocol for RRN3 antibody 25918-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Nucleolar localization signal and histone methylation reader function is required for SPIN1 to promote rRNA gene expression. | ||















