RRN3 Polyclonal antibody

• 

  WB analysis of HeLa using 25918-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25918-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 25918-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25918-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 25918-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25918-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25918-1-AP (RRN3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 25918-1-AP

  IP result of anti-RRN3 (IP:25918-1-AP, 4ug; Detection:25918-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IHC staining of mouse testis using 25918-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25918-1-AP (RRN3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 25918-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25918-1-AP (RRN3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RRN3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25918-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, chIP, ELISA

Synonyms

RNA polymerase I-specific transcription initiation factor RRN3, TIF IA, TIFIA, TIF-IA

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, K-562 cells, mouse testis tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• ChIP: See 1 publications below

Product Information

25918-1-AP targets RRN3 in WB, IHC, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23207

  Product name: Recombinant human RRN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 268-365 aa of BC132688

  Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ

• Full Name: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC132688
• Gene Symbol: RRN3
• Gene ID (NCBI): 54700
• RRID: AB_2880296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYV6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRN3, also known as transcription initiation factor IA, is a key regulatory protein essential for RNA polymerase I-mediated ribosomal DNA transcription. It functions as a bridge molecule that precisely regulates the recruitment of RNA polymerase I to the rDNA promoter and the assembly of the transcription initiation complex by integrating intra- and extracellular signals (such as growth factors, nutrient status, and cellular stress). The activity of RRN3 is tightly controlled by multiple signaling pathways. Specifically, the mTOR and MAPK pathways can activate RRN3 through phosphorylation, thereby promoting ribosomal RNA synthesis and ultimately influencing cell growth and proliferation. Studies have shown that RRN3 is abnormally highly expressed in various cancer cells and is closely associated with malignant tumor progression, making it a potential therapeutic target for anticancer strategies.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	chIP	Biochem Biophys Res Commun; Nucleolar localization signal and histone methylation reader function is required for SPIN1 to promote rRNA gene expression.; Authors - Xiaolei Zhang
	WB	Mol Cell; Control of ribosomal RNA synthesis by hematopoietic transcription factors; Authors - Charles Antony
human	WB	Mol Biol Cell; A role for the kinetochore protein, NUF2, in ribosome biogenesis; Authors - Ty J Brown