Tested Applications
Positive WB detected in | Jurkat cells, HeLa cells, K-562 cells, mouse testis tissue |
Positive IP detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
ChIP | See 1 publications below |
Product Information
25918-1-AP targets RRN3 in WB, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23207 Product name: Recombinant human RRN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 268-365 aa of BC132688 Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ Predict reactive species |
Full Name | RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
Observed Molecular Weight | 74 kDa |
GenBank Accession Number | BC132688 |
Gene Symbol | RRN3 |
Gene ID (NCBI) | 54700 |
RRID | AB_2880296 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NYV6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RRN3 antibody 25918-1-AP | Download protocol |
IP protocol for RRN3 antibody 25918-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biochem Biophys Res Commun Nucleolar localization signal and histone methylation reader function is required for SPIN1 to promote rRNA gene expression. | ||