Tested Applications
| Positive WB detected in | mouse thymus tissue, Jurkat cells, Rat thymus tissue |
| Positive IP detected in | Jurkat cells |
| Positive IF/ICC detected in | U-251 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 35 publications below |
| IF | See 8 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
| ChIP | See 6 publications below |
Product Information
25315-1-AP targets RUNX1 (middle) in WB, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17838 Product name: Recombinant human RUNX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 214-277 aa of BC136381 Sequence: TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSP Predict reactive species |
| Full Name | runt-related transcription factor 1 |
| Calculated Molecular Weight | 480 aa, 52 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC136381 |
| Gene Symbol | RUNX1 |
| Gene ID (NCBI) | 861 |
| RRID | AB_2880026 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01196 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Runt-related transcription factor 1 (RUNX1), also named AML1 or CBF alpha 2, is a 453 amino acid protein, which contains one Runt domain. RUNX1 localizes in the nucleus and is expressed in all tissues except the brain and heart. RUNX1 is involved in hematopoiesis and is frequently targeted in human leukemia by chromosomal translocations that fuse the DNA-binding domain of RUNX1 to other transcription factors and corepressor molecules. In addition to its role in leukemogenesis, RUNX1 is also involved in sensory neuron diversification. RUNX1 exists in some isoforms with a range of MV 20-52 kDa. The calculated molecular weight of isoform 1 is 49 kDa, but the modified protein is about 49-55 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RUNX1 (middle) antibody 25315-1-AP | Download protocol |
| IP protocol for RUNX1 (middle) antibody 25315-1-AP | Download protocol |
| WB protocol for RUNX1 (middle) antibody 25315-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity The Transcription Factor Runx3 Establishes Chromatin Accessibility of cis-Regulatory Landscapes that Drive Memory Cytotoxic T Lymphocyte Formation. | ||
Genes Dev ASCL1 represses a SOX9+ neural crest stem-like state in small cell lung cancer. | ||
J Hematol Oncol RUNX1 mutations promote leukemogenesis of myeloid malignancies in ASXL1-mutated leukemia. | ||
Int Immunopharmacol miR-9 targeting RUNX1 improves LPS-induced alveolar hypercoagulation and fibrinolysis inhibition through NF-κB inactivation in ARDS | ||
J Cell Physiol Inhibition of RUNX1 blocks the differentiation of lung fibroblasts to myofibroblasts.
| ||
Eur J Pharmacol Vitamin D3 analogue calcipotriol inhibits the profibrotic effects of transforming growth factor- β1 on pancreatic stellate cells |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S (Verified Customer) (08-14-2024) | Excellent
![]() |
FH SD (Verified Customer) (07-08-2022) | Excellent Antibody!
![]() |
FH P (Verified Customer) (12-01-2021) | Excellent
![]() |












