RUNX3 Polyclonal antibody, PBS Only

• 

  WB analysis using 27099-1-AP (same clone as 27099-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 27099-1-AP (RUNX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27099-1-PBS in a different storage buffer formulation.

RUNX3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27099-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AML2, CBF alpha 3, CBFA3, CBF-alpha-3, Core-binding factor subunit alpha-3

---

Product Information

27099-1-PBS targets RUNX3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24339

  Product name: Recombinant human RUNX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-251 aa of BC013362

  Sequence: PFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTS

• Full Name: runt-related transcription factor 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC013362
• Gene Symbol: RUNX3
• Gene ID (NCBI): 864
• RRID: AB_2880754
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13761
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RUNX3, also known as AML2, CBFA3 and PEBP2A3, is a member of the RUNX family of transcription factors, which are crucial regulators of embryonic development and play key roles in various biological processes such as cell proliferation, apoptosis, differentiation and lineage commitment (PMID: 38430423). This protein functions as a tumour suppressor and is frequently deleted or transcriptionally silenced in various cancers, including gastric and colon cancer.