Tested Applications
| Positive IHC detected in | mouse brain tissue, human cerebellum tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26968-1-AP targets RYR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species |
| Full Name | ryanodine receptor 1 (skeletal) |
| Calculated Molecular Weight | 565 kDa |
| GenBank Accession Number | NM_000540 |
| Gene Symbol | RYR1 |
| Gene ID (NCBI) | 6261 |
| RRID | AB_2880703 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21817 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RYR1 antibody 26968-1-AP | Download protocol |
| IHC protocol for RYR1 antibody 26968-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RYR1 Polyclonal antibody (Cat# 26968-1-AP) has accumulated 4 citations appearing in JCI Insight, Poultry Science, Animals (Basel), and Toxicology Research. The associated research fields include postnatal muscle hypertrophy and energy metabolism, calcium homeostasis and apoptosis in poultry breast muscle, endoplasmic reticulum calcium signaling in yak oviductal cells, and intracellular calcium dynamics in oxidative neurodegeneration.
| Species | Application | Title |
|---|---|---|
JCI Insight Muscle specific ER-associated degradation maintains postnatal muscle hypertrophy and systemic energy metabolism | ||
Poult Sci Effects of chronic heat stress on Ca2+ homeostasis, apoptosis, and protein carbonylation profiles in the breast muscle of broilers | ||
Animals (Basel) Estradiol Alleviates Elevated Temperature-Induced Damage in Yak Oviductal Epithelial Cells by Maintaining Endoplasmic Reticulum Calcium Homeostasis | ||
Toxicol Res (Camb) Modulating intracellular calcium dynamics with alkaloids: A novel strategy against oxidative neurodegeneration |
