Tested Applications
Positive IHC detected in | mouse brain tissue, human cerebellum tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
26968-1-AP targets RYR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species |
Full Name | ryanodine receptor 1 (skeletal) |
Calculated Molecular Weight | 565 kDa |
GenBank Accession Number | NM_000540 |
Gene Symbol | RYR1 |
Gene ID (NCBI) | 6261 |
RRID | AB_2880703 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P21817 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for RYR1 antibody 26968-1-AP | Download protocol |
IF protocol for RYR1 antibody 26968-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
JCI Insight Muscle specific ER-associated degradation maintains postnatal muscle hypertrophy and systemic energy metabolism | ||
Poult Sci Effects of chronic heat stress on Ca2+ homeostasis, apoptosis, and protein carbonylation profiles in the breast muscle of broilers |