Tested Applications
| Positive IHC detected in | mouse brain tissue, human cerebellum tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
26968-1-AP targets RYR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species |
| Full Name | ryanodine receptor 1 (skeletal) |
| Calculated Molecular Weight | 565 kDa |
| GenBank Accession Number | NM_000540 |
| Gene Symbol | RYR1 |
| Gene ID (NCBI) | 6261 |
| RRID | AB_2880703 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21817 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RYR1 antibody 26968-1-AP | Download protocol |
| IHC protocol for RYR1 antibody 26968-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
JCI Insight Muscle specific ER-associated degradation maintains postnatal muscle hypertrophy and systemic energy metabolism | ||
Toxicol Res (Camb) Modulating intracellular calcium dynamics with alkaloids: A novel strategy against oxidative neurodegeneration | ||
Poult Sci Effects of chronic heat stress on Ca2+ homeostasis, apoptosis, and protein carbonylation profiles in the breast muscle of broilers |















