Product Information
68730-1-PBS targets RYR3 as part of a matched antibody pair:
MP50018-1: 68730-1-PBS capture and 68730-2-PBS detection (validated in Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25978 Product name: Recombinant human RYR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 587-686 aa of NM_001036 Sequence: MLLDKHGRNHKVLDILCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWAS Predict reactive species |
| Full Name | ryanodine receptor 3 |
| Calculated Molecular Weight | 552 kDa |
| GenBank Accession Number | NM_001036 |
| Gene Symbol | RYR3 |
| Gene ID (NCBI) | 6263 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15413 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



