NF-κB p65 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NF-κB p65 Recombinant monoclonal antibody (87545-1-RR)

• 

  WB analysis using 87545-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87545-1-RR (Rela antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87545-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87545-1-RR against Mouse Rela were performed. The affinity constant is 0.432 nM.

NF-κB p65 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87545-1-RR

Clone No.252935D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Nfkb3, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, P65, Rela

---

Tested Applications

• Positive WB detected in: A431 cells, NIH/3T3 cells, HSC-T6 cells, PC-12 cells, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87545-1-RR targets NF-κB p65 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag40017

  Product name: Recombinant mouse Rela protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 425-549 aa of BC094053

  Sequence: KSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS*

• Full Name: v-rel reticuloendotheliosis viral oncogene homolog A (avian)
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC094053
• Gene Symbol: Rela
• Gene ID (NCBI): 19697
• RRID: AB_3745612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04207
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rela, also known as p65, is one of the most critical and extensively studied members of the nuclear factor κB (NF-κB) transcription factor family. As the core executor of the NF-κB signaling pathway, it typically forms the canonical p65-p50 heterodimer with the p50 subunit. In the resting state, Rela is anchored in the cytoplasm by the IκB inhibitory protein. Once the cell receives external stimuli such as inflammatory cytokines (TNF-α, IL-1), pathogen-associated molecular patterns (PAMPs), or stress signals, the IκB kinase (IKK) complex is activated, leading to the degradation of IκB and the release of Rela/p65. The activated Rela rapidly translocates to the nucleus, initiating the transcription of a large number of target genes that are widely involved in key biological processes such as acute inflammatory responses, cell survival, proliferation, and differentiation. Therefore, Rela serves as the core hub connecting upstream signals with downstream gene expression and plays a crucial role in immune responses, inflammatory diseases, and cancer.