Reticulocalbin 3 Polyclonal antibody

• 

  WB analysis of HeLa using 27497-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27497-1-AP (Reticulocalbin 3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 27497-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 27497-1-AP (Reticulocalbin 3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 27497-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 27497-1-AP (Reticulocalbin 3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Reticulocalbin 3 Polyclonal Antibody for WB, ELISA

Cat No. 27497-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

RCN3, Reticulocalbin 3, RLP49

---

Tested Applications

• Positive WB detected in: HeLa cells, U2OS cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27497-1-AP targets Reticulocalbin 3 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26569

  Product name: Recombinant human RCN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-161 aa of BC013436

  Sequence: LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETY

• Full Name: reticulocalbin 3, EF-hand calcium binding domain
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC013436
• Gene Symbol: Reticulocalbin 3
• Gene ID (NCBI): 57333
• RRID: AB_2880890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96D15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.