Tested Applications
Positive WB detected in | HeLa cells, U2OS cells, K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27497-1-AP targets Reticulocalbin 3 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26569 Product name: Recombinant human RCN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 71-161 aa of BC013436 Sequence: LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETY Predict reactive species |
Full Name | reticulocalbin 3, EF-hand calcium binding domain |
Calculated Molecular Weight | 37 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC013436 |
Gene Symbol | Reticulocalbin 3 |
Gene ID (NCBI) | 57333 |
RRID | AB_2880890 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96D15 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Reticulocalbin 3 antibody 27497-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |