S100A1 Monoclonal antibody

• 

  IHC staining of human tonsillitis using 67237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67237-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67237-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67237-1-Ig (S100A1 antibody) at dilution of 1:17000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 67237-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 67237-1-Ig against Human S100A1 was performed. The affinity constant is 7.37 nM.

S100A1 Monoclonal Antibody for IHC, ELISA

Cat No. 67237-1-Ig

Clone No.1A8C1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IHC, ELISA

Synonyms

1A8C1, Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:16000-1:64000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67237-1-Ig targets S100A1 in IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19544

  Product name: Recombinant human S100A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-94 aa of BC014392

  Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Full Name: S100 calcium binding protein A1
• Calculated Molecular Weight: 94 aa, 11 kDa
• GenBank Accession Number: BC014392
• Gene Symbol: S100A1
• Gene ID (NCBI): 6271
• RRID: AB_3085037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P23297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.