Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 3 publications below |
Product Information
16630-1-AP targets S100A12 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9961 Product name: Recombinant human S100A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC070294 Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Predict reactive species |
| Full Name | S100 calcium binding protein A12 |
| Calculated Molecular Weight | 92 aa, 11 kDa |
| GenBank Accession Number | BC070294 |
| Gene Symbol | S100A12 |
| Gene ID (NCBI) | 6283 |
| RRID | AB_2878290 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P80511 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A12 is expressed abundantly in granulocytes, and has been implicated to play an important role on inflammatory reactions in various disease states.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for S100A12 antibody 16630-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biol Reprod Effects of progesterone and interferon tau on ovine endometrial phosphate, calcium, and vitamin D signaling. | ||
Redox Biol Lipoxin A4 ameliorates knee osteoarthritis progression in rats by antagonizing ferroptosis through activation of the ESR2/LPAR3/Nrf2 axis in synovial fibroblast-like synoviocytes | ||
Connect Tissue Res S100A12 is involved in the pathology of osteoarthritis by promoting M1 macrophage polarization via the NF-κB pathway | ||
Nat Commun Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells | ||
Front Immunol Identification and validation of neutrophil-related biomarkers in acute-on-chronic liver failure | ||











