S100A3 Polyclonal antibody

• 

  WB analysis of A2780 using 12343-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12343-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skin using 12343-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

S100A3 Polyclonal Antibody for WB, ELISA

Cat No. 12343-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Protein S 100E, Protein S100 A3, S100A3, S100E

---

Tested Applications

• Positive WB detected in: A2780 cells, HeLa cells, mouse skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

12343-1-AP targets S100A3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2995

  Product name: Recombinant human S100A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC012893

  Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

• Full Name: S100 calcium binding protein A3
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 7 kDa, 12 kDa
• GenBank Accession Number: BC012893
• Gene Symbol: S100A3
• Gene ID (NCBI): 6274
• RRID: AB_2183761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P33764
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; Hypoxia-immune-related microenvironment prognostic signature for osteosarcoma; Authors - Wenshuo Zhang
mouse	WB	PLoS One; Multiple roles of integrin-linked kinase in epidermal development, maturation and pigmentation revealed by molecular profiling.; Authors - Judah David D
human	WB	DNA Cell Biol; miR-1 Regulates Differentiation and Proliferation of Goat Hair Follicle Stem Cells by Targeting IGF1R and LEF1 Genes.; Authors - Hailong Yan