Tested Applications
Positive WB detected in | A2780 cells, HeLa cells, mouse skin tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
12343-1-AP targets S100A3 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2995 Product name: Recombinant human S100A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC012893 Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ Predict reactive species |
Full Name | S100 calcium binding protein A3 |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 7 kDa, 12 kDa |
GenBank Accession Number | BC012893 |
Gene Symbol | S100A3 |
Gene ID (NCBI) | 6274 |
RRID | AB_2183761 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P33764 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for S100A3 antibody 12343-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Cell Dev Biol Hypoxia-immune-related microenvironment prognostic signature for osteosarcoma | ||
PLoS One Multiple roles of integrin-linked kinase in epidermal development, maturation and pigmentation revealed by molecular profiling. | ||
DNA Cell Biol miR-1 Regulates Differentiation and Proliferation of Goat Hair Follicle Stem Cells by Targeting IGF1R and LEF1 Genes. |