S100A8 Polyclonal antibody

• 

  WB analysis using 32681-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32681-1-AP (S100a8 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse spleen using 32681-1-AP

  IP result of anti-S100A8 (IP:32681-1-AP, 4ug; Detection:32681-1-AP 1:3000) with mouse spleen tissue lysate 2480 ug.

• 

  IF Staining of NIH/3T3 using 32681-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using S100A8 antibody (32681-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

S100A8 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 32681-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Caga, Calgranulin-A, Chemotactic cytokine CP-10, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8

---

Tested Applications

• Positive WB detected in: rat spleen tissue, mouse spleen tissue
• Positive IP detected in: mouse spleen tissue
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32681-1-AP targets S100A8 in WB, IF/ICC, IP, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2959

  Product name: recombinant mouse S100a8 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-89 aa of NM_013650.2

  Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

• Full Name: S100 calcium binding protein A8 (calgranulin A)
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_013650.2
• Gene Symbol: S100a8
• Gene ID (NCBI): 20201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P27005
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. S100A8 may form homodimer or heterodimer with S100A9(16216873).