CoraLite® Plus 488-conjugated S100A8 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-66853

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 S100A8 antibody (CL488-66853, Clone: 1G11C8 ) at dilution of 1:200.

• 

  IF Staining of human tonsillitis using CL488-66853

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 S100A8 antibody (CL488-66853, Clone: 1G11C8 ) at dilution of 1:200.

• 

  IF Staining of human tonsillitis using CL488-66853

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 S100A8 antibody (CL488-66853, Clone: 1G11C8 ) at dilution of 1:200.

• 

  IF Staining of human tonsillitis using CL488-66853

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 S100A8 antibody (CL488-66853, Clone: 1G11C8 ) at dilution of 1:200.

S100A8 Monoclonal Antibody for IF-P

Cat No. CL488-66853

Clone No.1G11C8

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF-P

Synonyms

60B8AG, CAGA, Calgranulin A, Calprotectin L1L subunit, CFAG, CGLA, CP 10, Cystic fibrosis antigen, L1Ag, MA387, MIF, MRP 8, MRP8, NIF, P8, Protein S100 A8, S100A8, Urinary stone protein band A

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66853 targets S100A8 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8517

  Product name: Recombinant human S100A8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-93 aa of BC005928

  Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Full Name: S100 calcium binding protein A8
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC005928
• Gene Symbol: S100A8
• Gene ID (NCBI): 6279
• RRID: AB_2919379
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05109
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.