CoraLite® Plus 488-conjugated S100A8 Monoclonal antibody

S100A8 Monoclonal Antibody for IF-P
Cat No. CL488-66853
Clone No.1G11C8

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF-P

60B8AG, CAGA, Calgranulin A, Calprotectin L1L subunit, CFAG, CGLA, CP 10, Cystic fibrosis antigen, L1Ag, MA387, MIF, MRP 8, MRP8, NIF, P8, Protein S100 A8, S100A8, Urinary stone protein band A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66853 targets S100A8 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8517

Product name: Recombinant human S100A8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-93 aa of BC005928

Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Predict reactive species
Full Name S100 calcium binding protein A8
Calculated Molecular Weight 93 aa, 11 kDa
GenBank Accession NumberBC005928
Gene Symbol S100A8
Gene ID (NCBI) 6279
RRIDAB_2919379
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05109
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 S100A8 antibody CL488-66853Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...