S100B Monoclonal antibody

S100B Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66616-1-Ig
Clone No.1G10F4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF-P, ELISA

S100 beta, 1G10F4, Protein S100 B, Protein S100-B, S100 calcium-binding protein B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrabbit brain tissue, rat brain tissue, rat cerebellum tissue, rat spinal cord tissue
Positive IHC detected inrat brain tissue, human appendicitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66616-1-Ig targets S100B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
RRIDAB_2881976
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04271
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders.

Protocols

Product Specific Protocols
IF protocol for S100B antibody 66616-1-IgDownload protocol
IHC protocol for S100B antibody 66616-1-IgDownload protocol
WB protocol for S100B antibody 66616-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Acta Neuropathol Commun

Repetitive mild TBI causes pTau aggregation in nigra without altering preexisting fibril induced Parkinson’s-like pathology burden

Authors - Vedad Delic
ratIHC

ACS Omega

Platelet-Rich Plasma Gel-Loaded Collagen/Chitosan Composite Film Accelerated Rat Sciatic Nerve Injury Repair

Authors - Bo Yuan
ratIF

Front Neurosci

Nogo-C Inhibits Peripheral Nerve Regeneration by Regulating Schwann Cell Apoptosis and Dedifferentiation.

Authors - Bo Jia
humanIF

Transl Oncol

High throughput proteomic and metabolic profiling identified target correction of metabolic abnormalities as a novel therapeutic approach in head and neck paraganglioma.

Authors - Zhigang Wang
ratWB,IF

Neurochem Int

Temporal and spatial expression of Phosphodiesterase-4B after sciatic nerve compression in rats and its mechanism of action on sciatic nerve repair

Authors - Yufei Wang
ratIF

Exp Neurol

Motor neurons transplantation alleviates neurofibrogenesis during chronic degeneration by reversibly regulating Schwann cells epithelial-mesenchymal transition

Authors - Zhaoyang Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kateryna (Verified Customer) (01-16-2025)

The S100B antibody was utilized to assess the identity of the immunomagnetically isolated astrocytic fraction by Western blot. As a positive control, mouse primary cortical astrocytes were used. As negative controls, mouse primary cortical neurons and microglial cells were used. The samples were processed by SDS-PAGE, and the separated proteins were transferred onto a nitrocellulose membrane. Blocking was performed with 5% non-fat dry milk, and the membrane was incubated overnight at 4°C with the S100B antibody. The antibody is specific and performs consistently.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain astrocytes
S100B Antibody Western Blot validation (1:1000 dilution) in Mouse brain astrocytes (Cat no:66616-1-Ig)
FH

Kateryna (Verified Customer) (11-21-2024)

I use the S100B monoclonal antibody (66616-1-Ig) to validate the identity of immunomagnetically isolated astrocytes from mouse brain via Western blot and as a housekeeping protein for other protein measurements via Western blot. The Western blot is run under reducing conditions using SDS-PAGE, a nitrocellulose membrane, and 5% non-fat dry milk as a blocking solution. The antibody is highly sensitive, providing consistent bands at 11 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain astrocytes
S100B Antibody Western Blot validation (1:1000 dilution) in Mouse brain astrocytes (Cat no:66616-1-Ig)
FH

Reyes (Verified Customer) (07-02-2024)

s100b (in green) works in human brain FFPE tissue, but it does not yield the best results. (It colocalizes in a small way with NeuN in red).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
S100B Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:66616-1-Ig)
FH

Gabriele (Verified Customer) (06-06-2024)

The antibody works well, staining positively the hiPSC-derived astrocytes in green (1:200). It can colocalize with GFAP (in red). Nuclei are stained with hoechst (in blue)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: hiPSC-derived Astrocytes
S100B Antibody Immunofluorescence validation (1:200 dilution) in hiPSC-derived Astrocytes (Cat no:66616-1-Ig)
FH

Clarisse (Verified Customer) (08-08-2022)

This antibody works very well as an astrocyte marker. In the image: in green mouse anti-S100B (1:500 - 66616-1-Ig) and in magenta rabbit anti-S100B (1:500 - 15146-1-AP). The rabbit antibody has a better performance.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human cerebral organoids
S100B Antibody Immunofluorescence validation (1:500 dilution) in Human cerebral organoids (Cat no:66616-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...