Tested Applications
Positive IHC detected in | mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18340-1-AP targets S100G/Calbindin-D9k in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13109 Product name: Recombinant human S100G protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC112174 Sequence: MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ Predict reactive species |
Full Name | S100 calcium binding protein G |
Calculated Molecular Weight | 79 aa, 9 kDa |
GenBank Accession Number | BC112174 |
Gene Symbol | S100G |
Gene ID (NCBI) | 795 |
RRID | AB_3085561 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P29377 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100G also named calbindin D9K, is a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for S100G/Calbindin-D9k antibody 18340-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |