S100a10 Polyclonal antibody

• 

  WB analysis using 31196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31196-1-AP (S100a10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

S100a10 Polyclonal Antibody for WB, ELISA

Cat No. 31196-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

42C, AL024248, CAL12, Cal1l, CLP11

---

Tested Applications

• Positive WB detected in: HaCaT cells, RAW 264.7 cells, mouse lung tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31196-1-AP targets S100a10 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35034

  Product name: Recombinant mouse S100a10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of NM_009112

  Sequence: MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK

• Full Name: S100 calcium binding protein A10 (calpactin)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_009112
• Gene Symbol: S100a10
• Gene ID (NCBI): 20194
• RRID: AB_3669895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P08207
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A10 (also known as p11) is a member of the S100 family of EF-hand-type Ca2+-binding proteins and participates in various biological processes . The overexpression of S100A10 and S100A2 in CRCs may be used for prognosis assessment in relapse CRCs after adjuvant 5-fluorouracil (5-Fu) therapy and radical surgery. S100A10 usually associates with annexin A2 (ANXA2, p36) to form a heterotetramer complex (AIIt) and is mainly localized to the cell membrane and cytoplasm. (PMID: 34336846)