Tested Applications
| Positive WB detected in | HaCaT cells, RAW 264.7 cells, mouse lung tissue, mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31196-1-AP targets S100a10 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35034 Product name: Recombinant mouse S100a10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of NM_009112 Sequence: MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK Predict reactive species |
| Full Name | S100 calcium binding protein A10 (calpactin) |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_009112 |
| Gene Symbol | S100a10 |
| Gene ID (NCBI) | 20194 |
| RRID | AB_3669895 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P08207 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A10 (also known as p11) is a member of the S100 family of EF-hand-type Ca2+-binding proteins and participates in various biological processes . The overexpression of S100A10 and S100A2 in CRCs may be used for prognosis assessment in relapse CRCs after adjuvant 5-fluorouracil (5-Fu) therapy and radical surgery. S100A10 usually associates with annexin A2 (ANXA2, p36) to form a heterotetramer complex (AIIt) and is mainly localized to the cell membrane and cytoplasm. (PMID: 34336846)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for S100a10 antibody 31196-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

