Tested Applications
Positive WB detected in | mouse eye tissue |
Positive IF-P detected in | rat eye tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
23546-1-AP targets Retinal S antigen in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20318 Product name: Recombinant human SAG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 332-405 aa of BC156656 Sequence: QIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE Predict reactive species |
Full Name | S-antigen; retina and pineal gland (arrestin) |
Calculated Molecular Weight | 405 aa, 45 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC156656 |
Gene Symbol | Retinal S antigen |
Gene ID (NCBI) | 6295 |
RRID | AB_2879294 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10523 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Retinal S antigen antibody 23546-1-AP | Download protocol |
IF protocol for Retinal S antigen antibody 23546-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |