SALL2 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 12679-1-AP (same clone as 12679-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12679-1-AP (SALL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12679-1-PBS in a different storage buffer formulation.

SALL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12679-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12679-1-PBS targets SALL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3367

  Product name: Recombinant human SALL2 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-198 aa of BC024245

  Sequence: MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA

• Full Name: sal-like 2 (Drosophila)
• Calculated Molecular Weight: 1007 aa, 105 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC024245
• Gene Symbol: SALL2
• Gene ID (NCBI): 6297
• RRID: AB_2183243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y467
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.