Product Information
26275-1-AP targets SAMD10 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22007 Product name: Recombinant human SAMD10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-112 aa of BC067362 Sequence: MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLLQQPGTDTPQGRLYSDHYGLYHTSPSLGGLT Predict reactive species |
Full Name | sterile alpha motif domain containing 10 |
Calculated Molecular Weight | 202 aa, 23 kDa |
GenBank Accession Number | BC067362 |
Gene Symbol | SAMD10 |
Gene ID (NCBI) | 140700 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BYL1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |