SAPK4 Polyclonal antibody

• 

SAPK4 Polyclonal Antibody for ELISA

Cat No. 24016-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

MAP kinase 13, MAP kinase p38 delta, MAPK 13, MAPK13, p38delta, PRKM13, SAPK4

---

Product Information

24016-1-AP targets SAPK4 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21240

  Product name: Recombinant human MAPK13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 307-365 aa of BC000433

  Sequence: FFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

• Full Name: mitogen-activated protein kinase 13
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC000433
• Gene Symbol: MAPK13
• Gene ID (NCBI): 5603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15264
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.