SAT2 Polyclonal antibody

• 

  WB analysis using 16246-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16246-1-AP (SAT2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 16246-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16246-1-AP (SAT2 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 16246-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16246-1-AP (SAT2 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SAT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16246-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Diamine acetyltransferase 2, SAT2, SSAT2

---

Tested Applications

• Positive WB detected in: rat liver tissue
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

16246-1-AP targets SAT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9179

  Product name: Recombinant human SAT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC011751

  Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK

• Full Name: spermidine/spermine N1-acetyltransferase family member 2
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC011751
• Gene Symbol: SAT2
• Gene ID (NCBI): 112483
• RRID: AB_2254874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96F10
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Spermidine/spermine N1-acetyltransferase 2 (SAT2) is a short-lived polyamine catabolic enzyme inducible by polyamines and polyamine analogues. Human SAT2 contains the highly conserved acetyl-CoA-binding domain and displays coactivator function to enhance NF-κB-dependent transcription and enhances TNFα-induced NF-κB activity (PMID: 17875644). Human SAT1 and SAT2 proteins, which share 46% amino acid sequence identity and are clearly homologous, both interact with HIF-1α and both promote the ubiquitination and degradation of HIF-1α (PMID: 17011643).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Toxicol In Vitro; Increased Sat2 expression is associated with busulfan-induced testicular Sertoli cell injury.; Authors - Yi Xian
mouse	WB	Neuropharmacology; A role of GABAA receptor α1 subunit in the hippocampus for rapid-acting antidepressant-like effects of ketamine; Authors - Xiao-Hui Tang