SC65 Polyclonal antibody

• 

  WB analysis of HeLa using 15288-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15288-1-AP (SC65 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15288-1-AP

  WB result of SC65 antibody (15288-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SC65 transfected HeLa cells.

• 

  WB analysis using 15288-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15288-1-AP (SC65 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse bladder using 15288-1-AP

  IP result of anti-SC65 (IP:15288-1-AP, 4ug; Detection:15288-1-AP 1:500) with mouse bladder tissue lysate 3200ug.

• Featured Product
• KD/KO Validated

SC65 Polyclonal Antibody for WB, IP, ELISA

Cat No. 15288-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IF, IHC, ELISA

Synonyms

NOL55, Nucleolar autoantigen No55, P3H4, SC65

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: mouse bladder tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

15288-1-AP targets SC65 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7480

  Product name: Recombinant human SC65 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-437 aa of BC001047

  Sequence: DGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQSRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLRAVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFKDFYPAIADLFAESLQCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA

• Full Name: synaptonemal complex protein SC65
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC001047
• Gene Symbol: SC65
• Gene ID (NCBI): 10609
• RRID: AB_2184611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92791
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SC65, also named as Leprecan-like protein 4 or Nucleolar autoantigen No55, is a 437 amino acid protein, which belongs to the leprecan family. SC65 ia a protein of the interphase nucleolus and tumour-associated autoantigen in patients with prostate cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	PLoS Genet; Sc65-Null Mice Provide Evidence for a Novel Endoplasmic Reticulum Complex Regulating Collagen Lysyl Hydroxylation.; Authors - Melissa E Heard ; KO Validated
human, mouse	WB,IF	J Bone Miner Res; Sc65 is a novel endoplasmic reticulum protein that regulates bone mass homeostasis.; Authors - Gruenwald Katrin K ; KD Validated
human	WB	Cancers (Basel); P3H4 Promotes Malignant Progression of Lung Adenocarcinoma via Interaction with EGFR.; Authors - Chen Fang ; KD Validated
mouse	WB	PLoS Genet; Cyclophilin B control of lysine post-translational modifications of skin type I collagen.; Authors - Masahiko Terajima
human	WB,IHC	Aging (Albany NY); Knockdown of P3H4 inhibits proliferation and invasion of bladder cancer.; Authors - Lin Hao ; KD Validated
human	WB	Sci Rep; Transcriptome analysis of a dog model of congestive heart failure shows that collagen-related 2-oxoglutarate-dependent dioxygenases contribute to heart failure; Authors - Takahiro Isono