SC65 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 15288-1-AP (same clone as 15288-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15288-1-AP (SC65 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15288-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15288-1-AP (same clone as 15288-1-PBS)

  WB result of SC65 antibody (15288-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SC65 transfected HeLa cells. This data was developed using the same antibody clone with 15288-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15288-1-AP (same clone as 15288-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15288-1-AP (SC65 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15288-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse bladder using 15288-1-AP (same clone as 15288-1-PBS)

  IP result of anti-SC65 (IP:15288-1-AP, 4ug; Detection:15288-1-AP 1:500) with mouse bladder tissue lysate 3200ug. This data was developed using the same antibody clone with 15288-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SC65 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 15288-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

15288-1-PBS targets SC65 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7480

  Product name: Recombinant human SC65 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-437 aa of BC001047

  Sequence: DGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQSRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLRAVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFKDFYPAIADLFAESLQCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA

• Full Name: synaptonemal complex protein SC65
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC001047
• Gene Symbol: SC65
• Gene ID (NCBI): 10609
• RRID: AB_2184611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92791
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SC65, also named as Leprecan-like protein 4 or Nucleolar autoantigen No55, is a 437 amino acid protein, which belongs to the leprecan family. SC65 ia a protein of the interphase nucleolus and tumour-associated autoantigen in patients with prostate cancer.