Tested Applications
| Positive WB detected in | HuH-7 cells, A549 cells, K-562 cells |
| Positive IP detected in | HepG2 cells, mouse heart tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26888-1-AP targets SCAMP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25256 Product name: Recombinant human SCAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species |
| Full Name | secretory carrier membrane protein 3 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC000161 |
| Gene Symbol | SCAMP3 |
| Gene ID (NCBI) | 10067 |
| RRID | AB_2810962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14828 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| IP protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| WB protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SCAMP3 antibody (Cat# 26888-1-AP) has 10 citations published in journals including Mol Cell, J Biol Chem, Phytomedicine, Int J Biol Macromol, Aging, Commun Biol, Sci Rep, Onco Targets Ther (×2), and Curr Biol. Research fields span lysosomal amino acid efflux/mTORC1 signaling, myocardial fibrosis, non-small cell lung cancer, pancreatic adenocarcinoma, PROTAC-mediated ubiquitylation, adipogenesis, lipid acylation proteomics, glioma, hepatocellular carcinoma, and exosome biogenesis.
| Species | Application | Title |
|---|---|---|
Mol Cell mTORC1 Activation Requires DRAM-1 by Facilitating Lysosomal Amino Acid Efflux.
| ||
Phytomedicine Gentianella acuta-derived Gen-miR-1 suppresses myocardial fibrosis by targeting HAX1/HMG20A/Smads axis to attenuate inflammation in cardiac fibroblasts | ||
Int J Biol Macromol Fungal antitumor protein D1 is internalized via endocytosis and inhibits non-small cell lung cancer proliferation through MAPK signaling pathway | ||
Aging (Albany NY) Expression and prognostic analyses of SCAMPs in pancreatic adenocarcinoma. | ||
Commun Biol Identification of E3 ligase substrates and PROTAC-induced ubiquitylation sites using proximity-based identification of ubiquitin sites (PrIUS). | ||
Sci Rep MicroRNA-27a/b-3p and PPARG regulate SCAMP3 through a feed-forward loop during adipogenesis. |
Reviews
What customers say
The sole review (3/5 stars, Feb 2024) reports that this antibody produced convincing immunofluorescence staining on HUVEC cells at a 1:200 dilution. However, when used for Western blot at 1:1000 on HUVEC lysate, it detected many unspecific bands. Overall, the reviewer found the antibody reliable for IF but less specific for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sammy (Verified Customer) (02-15-2024) | This antibody provided some convincing IF staining but detected many unspecific bands when western blotting HUVEC lysate.
|
