Tested Applications
| Positive WB detected in | HuH-7 cells, A549 cells, K-562 cells |
| Positive IP detected in | HepG2 cells, mouse heart tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
26888-1-AP targets SCAMP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25256 Product name: Recombinant human SCAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species |
| Full Name | secretory carrier membrane protein 3 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC000161 |
| Gene Symbol | SCAMP3 |
| Gene ID (NCBI) | 10067 |
| RRID | AB_2810962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14828 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| IP protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| WB protocol for SCAMP3 antibody 26888-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell mTORC1 Activation Requires DRAM-1 by Facilitating Lysosomal Amino Acid Efflux.
| ||
Aging (Albany NY) Expression and prognostic analyses of SCAMPs in pancreatic adenocarcinoma. | ||
Sci Rep MicroRNA-27a/b-3p and PPARG regulate SCAMP3 through a feed-forward loop during adipogenesis. | ||
Onco Targets Ther Bioinformatics Analysis and RNA-Sequencing of SCAMP3 Expression and Correlated Gene Regulation in Hepatocellular Carcinoma. | ||
Onco Targets Ther SCAMP3 Promotes Glioma Proliferation and Indicates Unfavorable Prognosis via Multiple Pathways.
| ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sammy (Verified Customer) (02-15-2024) | This antibody provided some convincing IF staining but detected many unspecific bands when western blotting HUVEC lysate.
|

















