SCD1 Polyclonal antibody

• 

  WB analysis using 28678-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28678-1-AP (SCD antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 28678-1-AP

  WB result of SCD antibody (28678-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SCD transfected A431 cells.

• 

  IHC staining of human liver using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brown adipose using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brown adipose using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 28678-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 28678-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SCD antibody (28678-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SCD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28678-1-AP

Publications(50)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

SCD, EC:1.14.19.1, Delta-9 desaturase, Delta(9)-desaturase, Delta(9) desaturase

---

Tested Applications

• Positive WB detected in: A431 cells, A375 cells, A549 cells, HepG2 cells
• Positive IHC detected in: mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 46 publications below
• IHC: See 6 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

28678-1-AP targets SCD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29156

  Product name: Recombinant human SCD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC005807

  Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

• Full Name: stearoyl-CoA desaturase (delta-9-desaturase)
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 28-42 kDa
• GenBank Accession Number: BC005807
• Gene Symbol: SCD
• Gene ID (NCBI): 6319
• RRID: AB_2923581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00767
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; 7-Dehydrocholesterol dictates ferroptosis sensitivity; Authors - Yaxu Li
human,mouse	WB,IHC	Adv Sci (Weinh); Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells; Authors - Ling Li
mouse	WB	ACS Appl Mater Interfaces; Lactate-Fueled Theranostic Nanoplatforms for Enhanced MRI-Guided Ferroptosis Synergistic with Immunotherapy of Hepatocellular Carcinoma; Authors - Xiaoxiao Chen
mouse	WB	Phytomedicine; Melittin suppresses ovarian cancer growth by regulating SREBP1-mediated lipid metabolism; Authors - Ruixin Wu
human	WB	Free Radic Biol Med; Zinc deficiency drives ferroptosis resistance by lactate production in esophageal squamous cell carcinoma; Authors - Peiyan Yang
human,mouse	WB	Inflammation; Multiple Machine Learning Identifies Key Gene PHLDA1 Suppressing NAFLD Progression; Authors - Zhenwei Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

YINGJIAN (Verified Customer) (08-07-2025)

The antibody demonstrates high specificity and strong affinity toward the target protein. Besides， the shipment very quick. It is overnight shipment.

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: liver

SCD1 Antibody Western Blot validation (1:5000 dilution) in liver (Cat no:28678-1-AP)

FH

Marco (Verified Customer) (07-09-2024)

It does its job in NRVCMs

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: NRVCMs