Tested Applications
| Positive WB detected in | A431 cells, A375 cells, A549 cells, HepG2 cells |
| Positive IHC detected in | mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 51 publications below |
| IHC | See 6 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
28678-1-AP targets SCD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
| Full Name | stearoyl-CoA desaturase (delta-9-desaturase) |
| Calculated Molecular Weight | 355 aa, 41 kDa |
| Observed Molecular Weight | 28-42 kDa |
| GenBank Accession Number | BC005807 |
| Gene Symbol | SCD |
| Gene ID (NCBI) | 6319 |
| RRID | AB_2923581 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00767 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SCD1 antibody 28678-1-AP | Download protocol |
| IHC protocol for SCD1 antibody 28678-1-AP | Download protocol |
| WB protocol for SCD1 antibody 28678-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells | ||
ACS Appl Mater Interfaces Lactate-Fueled Theranostic Nanoplatforms for Enhanced MRI-Guided Ferroptosis Synergistic with Immunotherapy of Hepatocellular Carcinoma | ||
Phytomedicine Melittin suppresses ovarian cancer growth by regulating SREBP1-mediated lipid metabolism | ||
Free Radic Biol Med Zinc deficiency drives ferroptosis resistance by lactate production in esophageal squamous cell carcinoma | ||
Inflammation Multiple Machine Learning Identifies Key Gene PHLDA1 Suppressing NAFLD Progression |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (08-07-2025) | The antibody demonstrates high specificity and strong affinity toward the target protein. Besides, the shipment very quick. It is overnight shipment.
![]() |
FH Marco (Verified Customer) (07-09-2024) | It does its job in NRVCMs
|


























