SCD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28678-1-AP (same clone as 28678-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28678-1-AP (SCD antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 28678-1-AP (same clone as 28678-1-PBS)

  WB result of SCD antibody (28678-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SCD transfected A431 cells. This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 28678-1-AP (same clone as 28678-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 28678-1-AP (same clone as 28678-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SCD antibody (28678-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28678-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SCD1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28678-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SCD, EC:1.14.19.1, Delta-9 desaturase, Delta(9)-desaturase, Delta(9) desaturase

---

Product Information

28678-1-PBS targets SCD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29156

  Product name: Recombinant human SCD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC005807

  Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

• Full Name: stearoyl-CoA desaturase (delta-9-desaturase)
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 28-42 kDa
• GenBank Accession Number: BC005807
• Gene Symbol: SCD
• Gene ID (NCBI): 6319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00767
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).