Tested Applications
Positive WB detected in | A431 cells, HepG2 cells, A375 cells, A549 cells, HEK-293T cells |
Positive FC (Intra) detected in | MCF-7 cells, HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
81468-2-RR targets SCD in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
Full Name | stearoyl-CoA desaturase (delta-9-desaturase) |
Calculated Molecular Weight | 355 aa, 41 kDa |
Observed Molecular Weight | 28-42 kDa |
GenBank Accession Number | BC005807 |
Gene Symbol | SCD |
Gene ID (NCBI) | 6319 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O00767 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SCD antibody 81468-2-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |