SCD Recombinant monoclonal antibody

SCD Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 81468-2-RR
Clone No.241487B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Delta-9 desaturase, Delta(9)-desaturase, Delta(9) desaturase, Acyl-CoA desaturase, Acyl CoA desaturase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HepG2 cells, A375 cells, A549 cells, HEK-293T cells
Positive FC (Intra) detected inMCF-7 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81468-2-RR targets SCD in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29156

Product name: Recombinant human SCD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-72 aa of BC005807

Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

Predict reactive species
Full Name stearoyl-CoA desaturase (delta-9-desaturase)
Calculated Molecular Weight 355 aa, 41 kDa
Observed Molecular Weight28-42 kDa
GenBank Accession NumberBC005807
Gene Symbol SCD
Gene ID (NCBI) 6319
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00767
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).

Protocols

Product Specific Protocols
WB protocol for SCD antibody 81468-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...