SCF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SCF Polyclonal antibody (26582-1-AP)

• Featured Product
• KD/KO Validated

SCF Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 26582-1-AP

Publications(22)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

KITLG, c Kit ligand, c-Kit ligand, KIT ligand, Kitl

• 

  WB analysis of PC-12 using 26582-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 26582-1-AP (SCF antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 26582-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 26582-1-AP (SCF antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26582-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 26582-1-AP (SCF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 26582-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26582-1-AP (SCF antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26582-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26582-1-AP (SCF antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 26582-1-AP

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human SCF (26582-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: PC-12 cells, NIH/3T3 cells, mouse colon tissue
• Positive IHC detected in: human kidney tissue, human small intestine tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26582-1-AP targets SCF in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25075

  Product name: Recombinant human SCF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-214 aa of BC074725

  Sequence: ICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

• Full Name: KIT ligand
• Calculated Molecular Weight: 273 aa, 31 kDa
• Observed Molecular Weight: 30-45 kDa
• GenBank Accession Number: BC074725
• Gene Symbol: SCF
• Gene ID (NCBI): 4254
• RRID: AB_2880561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21583
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stem cell factor (SCF) also known as mast cell growth factor, steel factor, and kit ligand, is a hematopoietic growth factor. SCF is a critical protein with key roles in the cell such as hematopoiesis, gametogenesis and melanogenesis. SCF activates multiple signal pathways by binding with c-kit receptor. SCF and its receptor, c-kit ligand (KL), are up-regulated in particular human malignancies including gastrointestinal stromal tumor (GISTs), breast cancer, hematopoietic cell, myeloid leukaemia, and glioma. The SCF/c-KIT system also plays a relevant role in cell fate decision, and its activity is widely known to control cell proliferation, differentiation, survival and apoptosis. SCF is a 35 to 45 kDa monomeric glycoprotein.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Food Res Int; Prunus persica (L.) Batsch blossom soluble dietary fiber synergia polyphenol improving loperamide-induced constipation in mice via regulating stem cell factor/C-kit, NF-κB signaling pathway and gut microbiota; Authors - Shan Liang
human	IHC	Int J Mol Sci; Increase in Chymase-Positive Mast Cells in Recurrent Pleomorphic Adenoma and Carcinoma Ex Pleomorphic Adenoma of the Parotid Gland.; Authors - Ichita Kinoshita
human	IHC	Int J Mol Sci; Increased Chymase-Positive Mast Cells in High-Grade Mucoepidermoid Carcinoma of the Parotid Gland; Authors - Hiromi Nishimura
mouse	WB,IHC	Am J Physiol Gastrointest Liver Physiol; miR-128 participates in the pathogenesis of chronic constipation by regulating the p38α/M-CSF inflammatory signaling pathway.; Authors - Yuntian Hong
mouse	WB,IHC	Exp Ther Med; Arctiin alleviates functional constipation by enhancing intestinal motility in mice; Authors - Yujin Wang
human	WB	Thorac Cancer; High expression of KITLG is a new hallmark activating the MAPK pathway in type A and AB thymoma.; Authors - Zhaoyu Yang ; KD Validated