• Featured Product
  • KD/KO Validated

SCF Polyclonal antibody

SCF Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 26582-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

KITLG, c Kit ligand, c-Kit ligand, KIT ligand, Kitl

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, NIH/3T3 cells, mouse colon tissue
Positive IHC detected inhuman kidney tissue, human small intestine tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26582-1-AP targets SCF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25075

Product name: Recombinant human SCF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-214 aa of BC074725

Sequence: ICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Predict reactive species
Full Name KIT ligand
Calculated Molecular Weight 273 aa, 31 kDa
Observed Molecular Weight 30-45 kDa
GenBank Accession NumberBC074725
Gene Symbol SCF
Gene ID (NCBI) 4254
RRIDAB_2880561
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21583
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stem cell factor (SCF) also known as mast cell growth factor, steel factor, and kit ligand, is a hematopoietic growth factor. SCF is a critical protein with key roles in the cell such as hematopoiesis, gametogenesis and melanogenesis. SCF activates multiple signal pathways by binding with c-kit receptor. SCF and its receptor, c-kit ligand (KL), are up-regulated in particular human malignancies including gastrointestinal stromal tumor (GISTs), breast cancer, hematopoietic cell, myeloid leukaemia, and glioma. The SCF/c-KIT system also plays a relevant role in cell fate decision, and its activity is widely known to control cell proliferation, differentiation, survival and apoptosis. SCF is a 35 to 45 kDa monomeric glycoprotein.

Protocols

Product Specific Protocols
FC protocol for SCF antibody 26582-1-APDownload protocol
IHC protocol for SCF antibody 26582-1-APDownload protocol
WB protocol for SCF antibody 26582-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Food Res Int

Prunus persica (L.) Batsch blossom soluble dietary fiber synergia polyphenol improving loperamide-induced constipation in mice via regulating stem cell factor/C-kit, NF-κB signaling pathway and gut microbiota

Authors - Shan Liang
humanIHC

Int J Mol Sci

Increase in Chymase-Positive Mast Cells in Recurrent Pleomorphic Adenoma and Carcinoma Ex Pleomorphic Adenoma of the Parotid Gland.

Authors - Ichita Kinoshita
humanIHC

Int J Mol Sci

Increased Chymase-Positive Mast Cells in High-Grade Mucoepidermoid Carcinoma of the Parotid Gland

Authors - Hiromi Nishimura
mouseWB,IHC

Am J Physiol Gastrointest Liver Physiol

miR-128 participates in the pathogenesis of chronic constipation by regulating the p38α/M-CSF inflammatory signaling pathway.

Authors - Yuntian Hong
mouseWB,IHC

Exp Ther Med

Arctiin alleviates functional constipation by enhancing intestinal motility in mice

Authors - Yujin Wang
humanWB

Thorac Cancer

High expression of KITLG is a new hallmark activating the MAPK pathway in type A and AB thymoma.

Authors - Zhaoyu Yang
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...