SCGB3A2 Polyclonal antibody

• 

  IHC staining of human lung using 26228-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 26228-1-AP (SCGB3A2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 26228-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 26228-1-AP (SCGB3A2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 26228-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 26228-1-AP (SCGB3A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 26228-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 26228-1-AP (SCGB3A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 26228-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using SCGB3A2 antibody (26228-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 26228-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using SCGB3A2 antibody (26228-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SCGB3A2 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 26228-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

Pneumo secretory protein 1, PnSP 1, PNSP1, PnSP-1, UGRP1

---

Tested Applications

• Positive IHC detected in: human lung tissue, mouse lung tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

26228-1-AP targets SCGB3A2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23969

  Product name: Recombinant human SCGB3A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-93 aa of BC024232

  Sequence: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

• Full Name: secretoglobin, family 3A, member 2
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC024232
• Gene Symbol: SCGB3A2
• Gene ID (NCBI): 117156
• RRID: AB_2880434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PL1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Mod Pathol; Single-Cell Transcriptome Analysis Reveals 2 Subtypes of Tumor Cells of Sclerosing Pneumocytoma With Distinct Molecular Features and Clinical Implications; Authors - Zhanxian Shang